(data stored in ACNUC29543 zone)

EMBL: CP000521.PE245

CP000521.PE245       Location/Qualifiers
FT   CDS             complement(278848..279903)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0252"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0252"
FT                   /db_xref="EnsemblGenomes-Tr:ABO10727"
FT                   /protein_id="ABO10727.2"
FT                   /translation="MCSALLLAGCSKTSEQDQTVSKEQKSTAQKATEQRDSSCLQIMVA
FT                   MHTINQNSKIEDLNQINEKLKTCVPSLKNEEQLKLIEASTAMYQRFLKQDYTDKTARAF
FT                   EAFGYAVLEQKQDLKKVIQSQKKLFAQLSPRDQYLLQHEGQAYIDLLYQGEGMFTYRRQ
FT                   PNYLVDVFSKALPADQKEFLSRMAKDNQNIFYNDGALAVSWKELTERALFWEKFIQKYP
FT                   KSYFINDAKLLFNEYRYFIFFGLDNTPVSNEYAPNTWFDPDALQQIRFLSTQSQSSLAK
FT                   PAQQFLKFIATPVDERNKQFKIDLTDENGQKKSTYQIVHEQLEQLLKFDSPWNTEVYRD
FT                   CHIDAVCIDTN"
     MCSALLLAGC SKTSEQDQTV SKEQKSTAQK ATEQRDSSCL QIMVAMHTIN QNSKIEDLNQ        60
     INEKLKTCVP SLKNEEQLKL IEASTAMYQR FLKQDYTDKT ARAFEAFGYA VLEQKQDLKK       120
     VIQSQKKLFA QLSPRDQYLL QHEGQAYIDL LYQGEGMFTY RRQPNYLVDV FSKALPADQK       180
     EFLSRMAKDN QNIFYNDGAL AVSWKELTER ALFWEKFIQK YPKSYFINDA KLLFNEYRYF       240
     IFFGLDNTPV SNEYAPNTWF DPDALQQIRF LSTQSQSSLA KPAQQFLKFI ATPVDERNKQ       300
     FKIDLTDENG QKKSTYQIVH EQLEQLLKFD SPWNTEVYRD CHIDAVCIDT N                351
//

If you have problems or comments...

PBIL Back to PBIL home page