(data stored in ACNUC29543 zone)

EMBL: CP000521.PE257

CP000521.PE257       Location/Qualifiers
FT   CDS             289598..290107
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0264"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0264"
FT                   /db_xref="EnsemblGenomes-Tr:ABO10739"
FT                   /protein_id="ABO10739.1"
FT                   /translation="MWQISRTVPELQQSLLQSEQQYANLNDQLVALQRQIQNQPSHNSK
FT                   TTPLATTEVVQTGIAPTVLIKQKLELIQFAIDQQQFIYAVDHLTQLQQTLPQYGIAPAL
FT                   QHSLNQALEQDKQAIQQFVLAQNQRHQLIDDLLQNIDKNIQQALKQPKFEMDQSEAVSW
FT                   WKMVPY"
     MWQISRTVPE LQQSLLQSEQ QYANLNDQLV ALQRQIQNQP SHNSKTTPLA TTEVVQTGIA        60
     PTVLIKQKLE LIQFAIDQQQ FIYAVDHLTQ LQQTLPQYGI APALQHSLNQ ALEQDKQAIQ       120
     QFVLAQNQRH QLIDDLLQNI DKNIQQALKQ PKFEMDQSEA VSWWKMVPY                   169
//

If you have problems or comments...

PBIL Back to PBIL home page