(data stored in ACNUC29543 zone)

EMBL: CP000521.PE258

CP000521.PE258       Location/Qualifiers
FT   CDS             290151..290369
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0265"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0265"
FT                   /db_xref="EnsemblGenomes-Tr:ABO10740"
FT                   /protein_id="ABO10740.1"
FT                   /translation="MLKEVQLRLLIAEQALNQGKMAEYQNELQTVMQKLNELPDATSQQ
FT                   LKNRIAKVAHLSVVPVPKLSTLGLIGS"
     MLKEVQLRLL IAEQALNQGK MAEYQNELQT VMQKLNELPD ATSQQLKNRI AKVAHLSVVP        60
     VPKLSTLGLI GS                                                            72
//

If you have problems or comments...

PBIL Back to PBIL home page