(data stored in ACNUC29543 zone)

EMBL: CP000521.PE259

CP000521.PE259       Location/Qualifiers
FT   CDS             290379..291572
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0266"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0266"
FT                   /db_xref="EnsemblGenomes-Tr:ABO10741"
FT                   /protein_id="ABO10741.2"
FT                   /translation="MKHLLWVYFLISLVLFAALALFSYGYGMGYVYIYWRQLQLQTNVW
FT                   GLVLTFVVMSFIAQVIWLWIKRYSSREQRKRENIFQFKNLHPYEQLGIVWLLEAAEDQR
FT                   VFIERVFTQSGLLKNIIDAKFLVLSGDYQKALEALDQSPPMAFELAELQRIEIFLAQNE
FT                   AERALTHLEFLYQHQLSPWLEEIETAYQQRLTALWGQLALQQPWVYLRSMKYGLLDAEH
FT                   RDLWLQQLLQQFDQASIDDLQALQQRYLDLESEIQTRPYSSKLLWLKLLARMPEMSIQH
FT                   EALTLHLLKEQFDPDVFYLWFQQQLLKQVPDYADVEEKINQFESQYMNLPVLTFAKWHV
FT                   YMATGRQAEAEILLSLYPDNILMSYLRIKSTLKEDDELIKQLNLIFENDANFLKFKI"
     MKHLLWVYFL ISLVLFAALA LFSYGYGMGY VYIYWRQLQL QTNVWGLVLT FVVMSFIAQV        60
     IWLWIKRYSS REQRKRENIF QFKNLHPYEQ LGIVWLLEAA EDQRVFIERV FTQSGLLKNI       120
     IDAKFLVLSG DYQKALEALD QSPPMAFELA ELQRIEIFLA QNEAERALTH LEFLYQHQLS       180
     PWLEEIETAY QQRLTALWGQ LALQQPWVYL RSMKYGLLDA EHRDLWLQQL LQQFDQASID       240
     DLQALQQRYL DLESEIQTRP YSSKLLWLKL LARMPEMSIQ HEALTLHLLK EQFDPDVFYL       300
     WFQQQLLKQV PDYADVEEKI NQFESQYMNL PVLTFAKWHV YMATGRQAEA EILLSLYPDN       360
     ILMSYLRIKS TLKEDDELIK QLNLIFENDA NFLKFKI                                397
//

If you have problems or comments...

PBIL Back to PBIL home page