(data stored in ACNUC29543 zone)

EMBL: CP000521.PE26

CP000521.PE26        Location/Qualifiers
FT   CDS             complement(33503..34303)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0026"
FT                   /product="alkanesulfonate transport protein"
FT                   /note="ABC superfamily atp_bind"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0026"
FT                   /db_xref="EnsemblGenomes-Tr:ABO10521"
FT                   /protein_id="ABO10521.2"
FT                   /translation="MTNLNLNINQNDVELIPENHPESQEPVVGAEILIEQLYKFYGEVK
FT                   VLEDLNLHIQPGEFLAIVGRSGCGKSTLLRLIAQLEKASFGEIKFKSARHLREGITNDD
FT                   IRVMFQDPRLLPWRNILQNVQLGLPKSQHALAEELLEKVGLKEKAGQWPSQLSGGQRQR
FT                   TALARALSHTPRILLLDEPLGALDALTRLEMQSLIERLWKEQGFTAILVTHDVSEAVQL
FT                   ADRIILLDKGQIAQSFQVNLPRPRKKSITFAQLEQQVLDAVLAT"
     MTNLNLNINQ NDVELIPENH PESQEPVVGA EILIEQLYKF YGEVKVLEDL NLHIQPGEFL        60
     AIVGRSGCGK STLLRLIAQL EKASFGEIKF KSARHLREGI TNDDIRVMFQ DPRLLPWRNI       120
     LQNVQLGLPK SQHALAEELL EKVGLKEKAG QWPSQLSGGQ RQRTALARAL SHTPRILLLD       180
     EPLGALDALT RLEMQSLIER LWKEQGFTAI LVTHDVSEAV QLADRIILLD KGQIAQSFQV       240
     NLPRPRKKSI TFAQLEQQVL DAVLAT                                            266
//

If you have problems or comments...

PBIL Back to PBIL home page