(data stored in ACNUC29543 zone)

EMBL: CP000521.PE263

CP000521.PE263       Location/Qualifiers
FT   CDS             293615..294451
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0270"
FT                   /product="putative general secretion pathway protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0270"
FT                   /db_xref="EnsemblGenomes-Tr:ABO10745"
FT                   /protein_id="ABO10745.2"
FT                   /translation="MKVWIDKLQQLQWQKLDRLSVVVLAILILWLCWKLASFFWLVIAP
FT                   PQLMQFDRVELGSQQPQIPNISTFSLFNEPSANAAQESVNLELQGVMVGYPNRFSSAVI
FT                   KIDNTAERYRVGETIGSTSYQLAEVYWDHVVLSQGNGSTRELQFKGLPNGLYQPMTPDA
FT                   SQQSATPSQPTEPMNTAQQALGQAIQQMQGNREQYLRDMGVSGNSGEGYEVTERTPTAL
FT                   RNKLGLRPGDRIVSLNGQTIGQGQTDVQLLEQARRAGQVKIEIKRGDQVMTIQQNF"
     MKVWIDKLQQ LQWQKLDRLS VVVLAILILW LCWKLASFFW LVIAPPQLMQ FDRVELGSQQ        60
     PQIPNISTFS LFNEPSANAA QESVNLELQG VMVGYPNRFS SAVIKIDNTA ERYRVGETIG       120
     STSYQLAEVY WDHVVLSQGN GSTRELQFKG LPNGLYQPMT PDASQQSATP SQPTEPMNTA       180
     QQALGQAIQQ MQGNREQYLR DMGVSGNSGE GYEVTERTPT ALRNKLGLRP GDRIVSLNGQ       240
     TIGQGQTDVQ LLEQARRAGQ VKIEIKRGDQ VMTIQQNF                               278
//

If you have problems or comments...

PBIL Back to PBIL home page