(data stored in ACNUC29543 zone)

EMBL: CP000521.PE264

CP000521.PE264       Location/Qualifiers
FT   CDS             294493..296769
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0271"
FT                   /product="putative general secretion pathway protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0271"
FT                   /db_xref="EnsemblGenomes-Tr:ABO10746"
FT                   /protein_id="ABO10746.2"
FT                   /translation="MALLNHQRPLWALLAAAPLIATVTSSAYAQTWKINLRDADLTAFI
FT                   NEVADITGKNFAVDPRVRGNVTVISNKPLNKDEVYDLFLGVLNVNGVVAIPSGNTIKLV
FT                   PDSNVKNSGIPYDSRNRVRGDQIVTRVIWLENTNPNDLIPALRPLMPQFAHMAAIAGTN
FT                   ALIISDRAANIYQLENIIRNLDGTGQNDIEAITLQSSQAEEIITQLEAMSATGASKDFS
FT                   GARIRIIADNRTNRILIKGDPQTRKRIRHMIEMLDVPSADRLGGLKVFRLKYASAKNLS
FT                   EILQGLVTGQAVSSSNNSNNSSNSSNPINSLIGNNQNSGSNTSGSNGASISTPAINLNG
FT                   NSNSSNQNNITSFNQNGVSIIADNAQNSLVVKADPQLMREIESAIQQLDVRRQQVLIEA
FT                   AIIEVSGDDADQLGIQWALGDLSSGIGLLSFSNVGASLSSIAAGYLSGGSAGAASAIAN
FT                   GANKGNGATLGLGNFDNSRKAYGALIQALKTNTKSNLLSTPSIVTMDNEEAYIVVGQNV
FT                   PFVTGSVTTNSTGINPYTTVERKDVGVTLKVVPHIGEGGTVRLEVEQEVSAVQDSRGQA
FT                   ADLVTSKRAIKTAVLAEHGQTVVLGGLVSDDTSLSRQGIPGLSSIPYVGRLFRSDNRSN
FT                   VKRNLLVFIHPTIVGDANDVRRLSQQRYNQLYSLQLAMDKNGNFAKLPEQVDDIYNQKM
FT                   TPPSIASKPKNYQQVPSGGKSSTITTPVAVEPTVQKQTLQLPDPEINRTKNTVTTTTLR
FT                   PSTAP"
     MALLNHQRPL WALLAAAPLI ATVTSSAYAQ TWKINLRDAD LTAFINEVAD ITGKNFAVDP        60
     RVRGNVTVIS NKPLNKDEVY DLFLGVLNVN GVVAIPSGNT IKLVPDSNVK NSGIPYDSRN       120
     RVRGDQIVTR VIWLENTNPN DLIPALRPLM PQFAHMAAIA GTNALIISDR AANIYQLENI       180
     IRNLDGTGQN DIEAITLQSS QAEEIITQLE AMSATGASKD FSGARIRIIA DNRTNRILIK       240
     GDPQTRKRIR HMIEMLDVPS ADRLGGLKVF RLKYASAKNL SEILQGLVTG QAVSSSNNSN       300
     NSSNSSNPIN SLIGNNQNSG SNTSGSNGAS ISTPAINLNG NSNSSNQNNI TSFNQNGVSI       360
     IADNAQNSLV VKADPQLMRE IESAIQQLDV RRQQVLIEAA IIEVSGDDAD QLGIQWALGD       420
     LSSGIGLLSF SNVGASLSSI AAGYLSGGSA GAASAIANGA NKGNGATLGL GNFDNSRKAY       480
     GALIQALKTN TKSNLLSTPS IVTMDNEEAY IVVGQNVPFV TGSVTTNSTG INPYTTVERK       540
     DVGVTLKVVP HIGEGGTVRL EVEQEVSAVQ DSRGQAADLV TSKRAIKTAV LAEHGQTVVL       600
     GGLVSDDTSL SRQGIPGLSS IPYVGRLFRS DNRSNVKRNL LVFIHPTIVG DANDVRRLSQ       660
     QRYNQLYSLQ LAMDKNGNFA KLPEQVDDIY NQKMTPPSIA SKPKNYQQVP SGGKSSTITT       720
     PVAVEPTVQK QTLQLPDPEI NRTKNTVTTT TLRPSTAP                               758
//

If you have problems or comments...

PBIL Back to PBIL home page