(data stored in ACNUC29543 zone)

EMBL: CP000521.PE268

CP000521.PE268       Location/Qualifiers
FT   CDS             300453..301643
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0279"
FT                   /product="protein chain elongation factor EF-Tu"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0279"
FT                   /db_xref="EnsemblGenomes-Tr:ABO10750"
FT                   /db_xref="GOA:A3M1F6"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR004160"
FT                   /db_xref="InterPro:IPR004161"
FT                   /db_xref="InterPro:IPR004541"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR009001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031157"
FT                   /db_xref="InterPro:IPR033720"
FT                   /db_xref="InterPro:IPR041709"
FT                   /db_xref="UniProtKB/Swiss-Prot:A3M1F6"
FT                   /protein_id="ABO10750.2"
FT                   /translation="MAKAKFERNKPHVNVGTIGHVDHGKTTLTAAIATICAKTYGGEAK
FT                   DYSQIDSAPEEKARGITINTSHVEYDSPTRHYAHVDCPGHADYVKNMITGAAQMDGAIL
FT                   VCAATDGPMPQTREHILLSRQVGVPYIIVFLNKCDLVDDEELLELVEMEVRELLSTYDF
FT                   PGDDTPVIRGSALAALNGEAGPYGEESVLALVAALDSYIPEPERAIDKAFLMPIEDVFS
FT                   ISGRGTVVTGRVEAGIIKVGEEVEIVGIKDTVKTTVTGVEMFRKLLDEGRAGENCGILL
FT                   RGTKREEVQRGQVLAKPGTIKPHTKFDAEVYVLSKEEGGRHTPFLNGYRPQFYFRTTDV
FT                   TGAIQLKEGVEMVMPGDNVEMSVELIHPIAMDPGLRFAIREGGRTVGAGVVAKVTA"
     MAKAKFERNK PHVNVGTIGH VDHGKTTLTA AIATICAKTY GGEAKDYSQI DSAPEEKARG        60
     ITINTSHVEY DSPTRHYAHV DCPGHADYVK NMITGAAQMD GAILVCAATD GPMPQTREHI       120
     LLSRQVGVPY IIVFLNKCDL VDDEELLELV EMEVRELLST YDFPGDDTPV IRGSALAALN       180
     GEAGPYGEES VLALVAALDS YIPEPERAID KAFLMPIEDV FSISGRGTVV TGRVEAGIIK       240
     VGEEVEIVGI KDTVKTTVTG VEMFRKLLDE GRAGENCGIL LRGTKREEVQ RGQVLAKPGT       300
     IKPHTKFDAE VYVLSKEEGG RHTPFLNGYR PQFYFRTTDV TGAIQLKEGV EMVMPGDNVE       360
     MSVELIHPIA MDPGLRFAIR EGGRTVGAGV VAKVTA                                 396
//

If you have problems or comments...

PBIL Back to PBIL home page