(data stored in ACNUC29543 zone)

EMBL: CP000521.PE269

CP000521.PE269       Location/Qualifiers
FT   CDS             301855..302295
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0281"
FT                   /product="preprotein translocase IISP family membrane
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0281"
FT                   /db_xref="EnsemblGenomes-Tr:ABO10751"
FT                   /protein_id="ABO10751.2"
FT                   /translation="MSNDKSRDALSDAPIPQRNNSAEVVRSGSPLDIVLWVIAIALLLS
FT                   ATMVNQHLPAYWAPANDVWVRVGVIFACIVVALGLLYATHQGKGFVRLLKDARVELRRV
FT                   TWPTKQETVTTSWQVLLVVVVASLVLWCFDYGLGWLIKLIIG"
     MSNDKSRDAL SDAPIPQRNN SAEVVRSGSP LDIVLWVIAI ALLLSATMVN QHLPAYWAPA        60
     NDVWVRVGVI FACIVVALGL LYATHQGKGF VRLLKDARVE LRRVTWPTKQ ETVTTSWQVL       120
     LVVVVASLVL WCFDYGLGWL IKLIIG                                            146
//

If you have problems or comments...

PBIL Back to PBIL home page