(data stored in ACNUC29543 zone)

EMBL: CP000521.PE27

CP000521.PE27        Location/Qualifiers
FT   CDS             complement(34317..35114)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0027"
FT                   /product="alkanesulfonate transport protein"
FT                   /note="ABC superfamily membrane"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0027"
FT                   /db_xref="EnsemblGenomes-Tr:ABO10522"
FT                   /protein_id="ABO10522.2"
FT                   /translation="MSKDINIVSRGTKQVGQRLLPWIFPIVLLVVWQIASSSGLLENRI
FT                   LPAPTAVVSAFWHLLISGELWQHVKVSAGRALLGLFIGGGLGLLLGLLNGSSRFASTLL
FT                   DTTLQMIRNIPALALIPLVILWFGIDETAKLFLVAVGVFFPIYINTYHGIRSVDPQLIE
FT                   MGKSYGLSRWQLYKEIILPGAMPSILVGLRFALGLVWVLLIVAETISAQAGIGYMTMNA
FT                   REFLQTDVVLVGILLYALLGKLADVLAQLLERYLLRWHAGYQK"
     MSKDINIVSR GTKQVGQRLL PWIFPIVLLV VWQIASSSGL LENRILPAPT AVVSAFWHLL        60
     ISGELWQHVK VSAGRALLGL FIGGGLGLLL GLLNGSSRFA STLLDTTLQM IRNIPALALI       120
     PLVILWFGID ETAKLFLVAV GVFFPIYINT YHGIRSVDPQ LIEMGKSYGL SRWQLYKEII       180
     LPGAMPSILV GLRFALGLVW VLLIVAETIS AQAGIGYMTM NAREFLQTDV VLVGILLYAL       240
     LGKLADVLAQ LLERYLLRWH AGYQK                                             265
//

If you have problems or comments...

PBIL Back to PBIL home page