(data stored in ACNUC29543 zone)

EMBL: CP000521.PE274

CP000521.PE274       Location/Qualifiers
FT   CDS             304941..305312
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0286"
FT                   /product="50S ribosomal protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0286"
FT                   /db_xref="EnsemblGenomes-Tr:ABO10756"
FT                   /db_xref="GOA:A3M1G2"
FT                   /db_xref="InterPro:IPR000206"
FT                   /db_xref="InterPro:IPR008932"
FT                   /db_xref="InterPro:IPR013823"
FT                   /db_xref="InterPro:IPR014719"
FT                   /db_xref="InterPro:IPR036235"
FT                   /db_xref="UniProtKB/Swiss-Prot:A3M1G2"
FT                   /protein_id="ABO10756.1"
FT                   /translation="MALTNEEILNAVAEKTVLELVELISAFEEKFNVSAAAVAVAAPAG
FT                   GAAAAAEEQSEFNVELTSFGANKVAVIKAVREATGLGLKEAKDLVEGAPQVLKEGVSKE
FT                   EGEELKKKLEEAGATVTLK"
     MALTNEEILN AVAEKTVLEL VELISAFEEK FNVSAAAVAV AAPAGGAAAA AEEQSEFNVE        60
     LTSFGANKVA VIKAVREATG LGLKEAKDLV EGAPQVLKEG VSKEEGEELK KKLEEAGATV       120
     TLK                                                                     123
//

If you have problems or comments...

PBIL Back to PBIL home page