(data stored in ACNUC29543 zone)

EMBL: CP000521.PE279

CP000521.PE279       Location/Qualifiers
FT   CDS             complement(315117..315614)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0289"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0289"
FT                   /db_xref="EnsemblGenomes-Tr:ABO10759"
FT                   /protein_id="ABO10759.2"
FT                   /translation="MAILKKLQNIPSISKFLFNHYPPYRGAGIYIEVMNLELCHVRVKM
FT                   PLTWKNQNLVGTHFGGSLYSMVDPFYMLILMHHLGSKYIVWDKAAEINFLSPGRSTVYA
FT                   DIRVDLAEIEQIRELAENYAPVLRTYHLNIFDESGVRIAEVQKTLYIRRKKAKPSTNKI
FT                   SA"
     MAILKKLQNI PSISKFLFNH YPPYRGAGIY IEVMNLELCH VRVKMPLTWK NQNLVGTHFG        60
     GSLYSMVDPF YMLILMHHLG SKYIVWDKAA EINFLSPGRS TVYADIRVDL AEIEQIRELA       120
     ENYAPVLRTY HLNIFDESGV RIAEVQKTLY IRRKKAKPST NKISA                       165
//

If you have problems or comments...

PBIL Back to PBIL home page