(data stored in ACNUC29543 zone)

EMBL: CP000521.PE282

CP000521.PE282       Location/Qualifiers
FT   CDS             318464..319045
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0292"
FT                   /product="putative outer membrane protein W"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0292"
FT                   /db_xref="EnsemblGenomes-Tr:ABO10762"
FT                   /protein_id="ABO10762.2"
FT                   /translation="MFKKALVIALMGVSSFTFAGNWQVKFGGSVIAPSEDTTTALGVVK
FT                   ADHEYAFTPSVEYFFGQSPFSAELLLATPVNHDVLLDGQKVARIKQLPPTITAKYHFKN
FT                   STRFTPYIGIGATAFIPWDEQGVADKVKEDFGVAGQIGFNFQPADAKNWGVFVDVRYAD
FT                   ISPEVTLTNGAKFDLDINPFVYTLGYSYKF"
     MFKKALVIAL MGVSSFTFAG NWQVKFGGSV IAPSEDTTTA LGVVKADHEY AFTPSVEYFF        60
     GQSPFSAELL LATPVNHDVL LDGQKVARIK QLPPTITAKY HFKNSTRFTP YIGIGATAFI       120
     PWDEQGVADK VKEDFGVAGQ IGFNFQPADA KNWGVFVDVR YADISPEVTL TNGAKFDLDI       180
     NPFVYTLGYS YKF                                                          193
//

If you have problems or comments...

PBIL Back to PBIL home page