(data stored in ACNUC29543 zone)

EMBL: CP000521.PE285

CP000521.PE285       Location/Qualifiers
FT   CDS             complement(322710..323849)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0297"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0297"
FT                   /db_xref="EnsemblGenomes-Tr:ABO10765"
FT                   /protein_id="ABO10765.2"
FT                   /translation="MKTFHIITYRQLFALLTLGFGSVCMAHAEVNSSSTQQVNGLSSGA
FT                   QAEENKDENLLDQIPRWIDATPTIFPEQSNEPIVPPTEQTEDQTWFDRKQKKIRNWADR
FT                   TSGKIDNWFGEVDPQKPASATIRVMIDNYWNEYDNYEIKPRIRGKIKLPTLEKRLSVVF
FT                   GDDSLDDEFNNSPANINQNPNQDPNKKLDGKRTRDDNSSIALRWSNFSKKLPFETDADL
FT                   GIRSGDDIYVRLKASRDWQLRNDFKFYAEQIYRYGIDSENYLRTNLELTHARPNQPILS
FT                   NQFSLTYADDQDDDLTWENRLFREHSFFANNRFNYGIYTGGYYNDNDLRLNSWGPFVSW
FT                   RQPVLREWFFVQGDLNYFNDHREDRNHYVSTFLRLEALF"
     MKTFHIITYR QLFALLTLGF GSVCMAHAEV NSSSTQQVNG LSSGAQAEEN KDENLLDQIP        60
     RWIDATPTIF PEQSNEPIVP PTEQTEDQTW FDRKQKKIRN WADRTSGKID NWFGEVDPQK       120
     PASATIRVMI DNYWNEYDNY EIKPRIRGKI KLPTLEKRLS VVFGDDSLDD EFNNSPANIN       180
     QNPNQDPNKK LDGKRTRDDN SSIALRWSNF SKKLPFETDA DLGIRSGDDI YVRLKASRDW       240
     QLRNDFKFYA EQIYRYGIDS ENYLRTNLEL THARPNQPIL SNQFSLTYAD DQDDDLTWEN       300
     RLFREHSFFA NNRFNYGIYT GGYYNDNDLR LNSWGPFVSW RQPVLREWFF VQGDLNYFND       360
     HREDRNHYVS TFLRLEALF                                                    379
//

If you have problems or comments...

PBIL Back to PBIL home page