(data stored in ACNUC29543 zone)

EMBL: CP000521.PE289

CP000521.PE289       Location/Qualifiers
FT   CDS             326395..326952
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0301"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0301"
FT                   /db_xref="EnsemblGenomes-Tr:ABO10769"
FT                   /protein_id="ABO10769.1"
FT                   /translation="MRQIFVLHGYSASINDHWFLDLKHQIEDENTTVTLIPFPDSEHPD
FT                   VDAWQKVLDEQIPAVNENTYFVAHSLGVITLLHFLQRHDYQNIGGMILVSGFSGPISDS
FT                   SPLSPYITKSKVDTNYFRDIKKKLVYLSDNDDLVPPQLTIQLAKDIDAPYITVPNGGHF
FT                   LGREGYTEFPQLVDSLKEMLEN"
     MRQIFVLHGY SASINDHWFL DLKHQIEDEN TTVTLIPFPD SEHPDVDAWQ KVLDEQIPAV        60
     NENTYFVAHS LGVITLLHFL QRHDYQNIGG MILVSGFSGP ISDSSPLSPY ITKSKVDTNY       120
     FRDIKKKLVY LSDNDDLVPP QLTIQLAKDI DAPYITVPNG GHFLGREGYT EFPQLVDSLK       180
     EMLEN                                                                   185
//

If you have problems or comments...

PBIL Back to PBIL home page