(data stored in ACNUC29543 zone)

EMBL: CP000521.PE291

CP000521.PE291       Location/Qualifiers
FT   CDS             328013..328504
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0303"
FT                   /product="putative peptide signal"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0303"
FT                   /db_xref="EnsemblGenomes-Tr:ABO10771"
FT                   /protein_id="ABO10771.2"
FT                   /translation="MNFLKQSAFIAVFAFMGLPTVQAEEVATLPTIRVMAESELREEVG
FT                   FVPFQEDKKVRQALQHREYKTHNDIQNALVPEGMTTVDYQPVMAQPDLSQLSPFLREYI
FT                   LAVAGGIQSSDPTNGLFEMLKPLQINRSNVDAYREGTMKVNLDDILKLQQQIQDGLKGR
FT                   "
     MNFLKQSAFI AVFAFMGLPT VQAEEVATLP TIRVMAESEL REEVGFVPFQ EDKKVRQALQ        60
     HREYKTHNDI QNALVPEGMT TVDYQPVMAQ PDLSQLSPFL REYILAVAGG IQSSDPTNGL       120
     FEMLKPLQIN RSNVDAYREG TMKVNLDDIL KLQQQIQDGL KGR                         163
//

If you have problems or comments...

PBIL Back to PBIL home page