(data stored in ACNUC29543 zone)

EMBL: CP000521.PE292

CP000521.PE292       Location/Qualifiers
FT   CDS             328558..331536
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0304"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0304"
FT                   /db_xref="EnsemblGenomes-Tr:ABO10772"
FT                   /protein_id="ABO10772.1"
FT                   /translation="MKNKRCGIIGVTILFKNKDMSTQLIAHLKKKCEADDNVKILLSQW
FT                   EFDQKLVGKALENIGGFYPHFSNHNASHSQQILVNIERILGNDIDLLTATDTWLILEAA
FT                   YWHDVGMLVDAKSAKDVHGNEDFQFMVKTIAHDKGHDLHTFCLAYEQSDWVGAIGSEDH
FT                   PFDGVEKYRQLIAEWFRRNHDKRIGGLVEDPFEFLNITSPRTELLPKRIYRYLGKICMS
FT                   HGMNFTDLMEKLPFKQTGLGTEDCHPRFIGCLLRLGDLFDLDDNRFCPVMAKHVSHQPR
FT                   LSKAHEDKHLSLREFQLDERTVKLVAECPNEMSYVETQNWFGWIREEFQNQMSQWNLIV
FT                   PNFKFGSLPTIEQLDVKMEVKYENGIRKEKILLHNKPMKFTIDEKNGIELLQGANLYKN
FT                   KLSIYRELIQNSIDSTMLRVWLENKDELIDLNPYDQKYLNIIKNYQLIIDLEKVKDIES
FT                   SLDSVWELSIKDKGIGISQNDLFYMQKMAGSDKNLEKKRIINEMPLWMRPSGKFGIGLH
FT                   SAFLLLENTLEDTDKKIKFKTCSYFNNENLEVEMFSPLGGKQGFCFINKIQDNLKHEYG
FT                   AEFLIKIKRKFILSYRGLYRKKSPVRWSREFIDDNWKKNLIDNIYRNIVLNSPINPKKD
FT                   IEDILWDADRCVAFKFDILSSNDFFGFRGQNTSFRSKSYHKFLCGIYIDYYNLDPSKAL
FT                   NISRDTWNLKFVNKIEEDIFYYMGEYVRKIKNENTSLLRKLYYNKLSIDCVDDGQWKDF
FT                   VFKFSGENKSINDLNKIEEFYIISNSDYPDNGYNSEFISSINKVKFFVVEERVALQIKL
FT                   LVEEFSNEVFPEHRALQMVDNQFLHYRCFYFSKRKSKPLSKVLDKKLYWGEIIKKSIEE
FT                   NINYSIEMCFKAMQVFTKLQLKNDYYYGTKTWYSYLMGVSVIRDVEIISDYKILCIKEG
FT                   EEEVVINPYQVVDNRIELTNLEELSALLVSYLNIDMSEYQKILHDYKRLQLKIEKDLGI
FT                   YIQ"
     MKNKRCGIIG VTILFKNKDM STQLIAHLKK KCEADDNVKI LLSQWEFDQK LVGKALENIG        60
     GFYPHFSNHN ASHSQQILVN IERILGNDID LLTATDTWLI LEAAYWHDVG MLVDAKSAKD       120
     VHGNEDFQFM VKTIAHDKGH DLHTFCLAYE QSDWVGAIGS EDHPFDGVEK YRQLIAEWFR       180
     RNHDKRIGGL VEDPFEFLNI TSPRTELLPK RIYRYLGKIC MSHGMNFTDL MEKLPFKQTG       240
     LGTEDCHPRF IGCLLRLGDL FDLDDNRFCP VMAKHVSHQP RLSKAHEDKH LSLREFQLDE       300
     RTVKLVAECP NEMSYVETQN WFGWIREEFQ NQMSQWNLIV PNFKFGSLPT IEQLDVKMEV       360
     KYENGIRKEK ILLHNKPMKF TIDEKNGIEL LQGANLYKNK LSIYRELIQN SIDSTMLRVW       420
     LENKDELIDL NPYDQKYLNI IKNYQLIIDL EKVKDIESSL DSVWELSIKD KGIGISQNDL       480
     FYMQKMAGSD KNLEKKRIIN EMPLWMRPSG KFGIGLHSAF LLLENTLEDT DKKIKFKTCS       540
     YFNNENLEVE MFSPLGGKQG FCFINKIQDN LKHEYGAEFL IKIKRKFILS YRGLYRKKSP       600
     VRWSREFIDD NWKKNLIDNI YRNIVLNSPI NPKKDIEDIL WDADRCVAFK FDILSSNDFF       660
     GFRGQNTSFR SKSYHKFLCG IYIDYYNLDP SKALNISRDT WNLKFVNKIE EDIFYYMGEY       720
     VRKIKNENTS LLRKLYYNKL SIDCVDDGQW KDFVFKFSGE NKSINDLNKI EEFYIISNSD       780
     YPDNGYNSEF ISSINKVKFF VVEERVALQI KLLVEEFSNE VFPEHRALQM VDNQFLHYRC       840
     FYFSKRKSKP LSKVLDKKLY WGEIIKKSIE ENINYSIEMC FKAMQVFTKL QLKNDYYYGT       900
     KTWYSYLMGV SVIRDVEIIS DYKILCIKEG EEEVVINPYQ VVDNRIELTN LEELSALLVS       960
     YLNIDMSEYQ KILHDYKRLQ LKIEKDLGIY IQ                                     992
//

If you have problems or comments...

PBIL Back to PBIL home page