(data stored in ACNUC29543 zone)

EMBL: CP000521.PE295

CP000521.PE295       Location/Qualifiers
FT   CDS             336585..337115
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0309"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0309"
FT                   /db_xref="EnsemblGenomes-Tr:ABO10775"
FT                   /protein_id="ABO10775.2"
FT                   /translation="MAHAHHAAHAYVHHIKVRKEESSQGDLKTKAMLSKASSGNKKLHR
FT                   PASKRHKSEDQNIDLHKFSSKLESMSAKHSKEKCAKNIRIALQAAGADVSKHPVAASDW
FT                   GQTLEKNGYKKIKPAFNRPQEGDIYIIERTSGHTYGHIAGYTGNGWFSDFRQKTYAVYK
FT                   EKDVKYSYYRLDS"
     MAHAHHAAHA YVHHIKVRKE ESSQGDLKTK AMLSKASSGN KKLHRPASKR HKSEDQNIDL        60
     HKFSSKLESM SAKHSKEKCA KNIRIALQAA GADVSKHPVA ASDWGQTLEK NGYKKIKPAF       120
     NRPQEGDIYI IERTSGHTYG HIAGYTGNGW FSDFRQKTYA VYKEKDVKYS YYRLDS           176
//

If you have problems or comments...

PBIL Back to PBIL home page