(data stored in ACNUC29543 zone)

EMBL: CP000521.PE30

CP000521.PE30        Location/Qualifiers
FT   CDS             complement(37368..38336)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0030"
FT                   /product="alkanesulfonate transport protein"
FT                   /note="ABC superfamily peri_bind"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0030"
FT                   /db_xref="EnsemblGenomes-Tr:ABO10525"
FT                   /protein_id="ABO10525.2"
FT                   /translation="MALFNSTSWAKYSVIAASLAGVMMLGGCAKKEEHTTTTLNIGYQK
FT                   YGILPILKARGDLEKALKDQGVQVKWVEFPAGPQLLEGLNVGSVSLGEAGEAPPIFAQA
FT                   ANPNLVYVANQPAAPKAEALLVQKDSPIQSIKDLKGKRVALNKGSNVHYLLLKVLEANH
FT                   LSLSDIQPVYLPPSDARAAFEKGAVDAWVIWDPFFAAAEHQIQARVLATGENLVSNHQF
FT                   YLADRKFAENNPKVLNTVVQTLNQTTEWVSTHQDEAAKLLEKPTALEFDVLKTSISRMG
FT                   FGVQPISDKVAQEQQYVADAFYAQKLIPNKLTIQEAILKLK"
     MALFNSTSWA KYSVIAASLA GVMMLGGCAK KEEHTTTTLN IGYQKYGILP ILKARGDLEK        60
     ALKDQGVQVK WVEFPAGPQL LEGLNVGSVS LGEAGEAPPI FAQAANPNLV YVANQPAAPK       120
     AEALLVQKDS PIQSIKDLKG KRVALNKGSN VHYLLLKVLE ANHLSLSDIQ PVYLPPSDAR       180
     AAFEKGAVDA WVIWDPFFAA AEHQIQARVL ATGENLVSNH QFYLADRKFA ENNPKVLNTV       240
     VQTLNQTTEW VSTHQDEAAK LLEKPTALEF DVLKTSISRM GFGVQPISDK VAQEQQYVAD       300
     AFYAQKLIPN KLTIQEAILK LK                                                322
//

If you have problems or comments...

PBIL Back to PBIL home page