(data stored in ACNUC29543 zone)

EMBL: CP000521.PE302

CP000521.PE302       Location/Qualifiers
FT   CDS             343717..345816
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0317"
FT                   /product="putative fusaric acid resistance protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0317"
FT                   /db_xref="EnsemblGenomes-Tr:ABO10781"
FT                   /protein_id="ABO10781.2"
FT                   /translation="MLLKQILAFRPSKLDLIFAIKTFIAGMLALFVSFELDLINPMWSI
FT                   GTVLIIANPYSGMVSSKCVYRLLGTVGGAIIALTITPHLINTPWIFTVVLSLWVGFALY
FT                   VSLLDRTPRSYAFMLAGYSTAMIVYNAITYIDQYNIFDIALARVLEISIGVISSAVVSA
FT                   TILPMHIGSAIKQRVTKTLKDTENLFANLLNADQQQNNTQLLAAITRDTTDIHALAVHL
FT                   SYEKGELHGMTKPLQEMLHQMSMVVANLVALSERIKQLQELNFIESHSDKLKQLSGHVI
FT                   HFLEQKDQMTDENILQLPDEFENDFLNLNDSASEHQQVLLAAMKMDVRHFISNVLAVKV
FT                   LWQRIKQGNKEIPDNITPMTTTYPSLHRDHGVAVRGGISAVLITFIVTGVWILSGWKAG
FT                   FMMAQIGAVTACILTALDNPVPVLRIFIWGSVASAVLVFIYAFGIFPHVTTFWELGLVL
FT                   LPMFLFAVSMMANQALMPVGMVLGINTMMGLNLHNAYSMDAVSYLDSSFGMVMGVLVSL
FT                   VVIDVVRAMSPDTSANRILALHYRAMRQAIYIPYGIEFKVHLRGMLDRVGVLNTKMVQS
FT                   EEIKKSIQQALVESSAIIDLSRLQELANQVPTSSELAHHIGRLQQDLDELFRAKENEKG
FT                   ESDVLVQHIHQTLFELKQLASNIEDMTLRQRLFISLNNIAYSMCHVSSNQMNADRTLTG
FT                   ATAHG"
     MLLKQILAFR PSKLDLIFAI KTFIAGMLAL FVSFELDLIN PMWSIGTVLI IANPYSGMVS        60
     SKCVYRLLGT VGGAIIALTI TPHLINTPWI FTVVLSLWVG FALYVSLLDR TPRSYAFMLA       120
     GYSTAMIVYN AITYIDQYNI FDIALARVLE ISIGVISSAV VSATILPMHI GSAIKQRVTK       180
     TLKDTENLFA NLLNADQQQN NTQLLAAITR DTTDIHALAV HLSYEKGELH GMTKPLQEML       240
     HQMSMVVANL VALSERIKQL QELNFIESHS DKLKQLSGHV IHFLEQKDQM TDENILQLPD       300
     EFENDFLNLN DSASEHQQVL LAAMKMDVRH FISNVLAVKV LWQRIKQGNK EIPDNITPMT       360
     TTYPSLHRDH GVAVRGGISA VLITFIVTGV WILSGWKAGF MMAQIGAVTA CILTALDNPV       420
     PVLRIFIWGS VASAVLVFIY AFGIFPHVTT FWELGLVLLP MFLFAVSMMA NQALMPVGMV       480
     LGINTMMGLN LHNAYSMDAV SYLDSSFGMV MGVLVSLVVI DVVRAMSPDT SANRILALHY       540
     RAMRQAIYIP YGIEFKVHLR GMLDRVGVLN TKMVQSEEIK KSIQQALVES SAIIDLSRLQ       600
     ELANQVPTSS ELAHHIGRLQ QDLDELFRAK ENEKGESDVL VQHIHQTLFE LKQLASNIED       660
     MTLRQRLFIS LNNIAYSMCH VSSNQMNADR TLTGATAHG                              699
//

If you have problems or comments...

PBIL Back to PBIL home page