(data stored in ACNUC29543 zone)

EMBL: CP000521.PE303

CP000521.PE303       Location/Qualifiers
FT   CDS             345809..346015
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_3495"
FT                   /old_locus_tag="AS1_3495"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_3495"
FT                   /db_xref="EnsemblGenomes-Tr:ABS89920"
FT                   /protein_id="ABS89920.2"
FT                   /translation="MGEFNVYGIYVPALLVQAIFAYICFRWLSPLTNKWIAQGWIALPS
FT                   IFNLCFYLLLLLVIHQIFVGLGA"
     MGEFNVYGIY VPALLVQAIF AYICFRWLSP LTNKWIAQGW IALPSIFNLC FYLLLLLVIH        60
     QIFVGLGA                                                                 68
//

If you have problems or comments...

PBIL Back to PBIL home page