(data stored in ACNUC29543 zone)

EMBL: CP000521.PE305

CP000521.PE305       Location/Qualifiers
FT   CDS             complement(347113..347553)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0319"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0319"
FT                   /db_xref="EnsemblGenomes-Tr:ABO10783"
FT                   /protein_id="ABO10783.2"
FT                   /translation="MTATQSKSIMAFDFGTQKMGMAIGQSAIESANPLPLFVMKDGIPN
FT                   WDQLLKIVKEWQPDLFIVGLPLNMDDSESELSTRARKFARRLRHQTNIETWMVDERLTT
FT                   REAREELGFYQEQGRAKKLSADSFAAALLIQSWYRNPVGLTP"
     MTATQSKSIM AFDFGTQKMG MAIGQSAIES ANPLPLFVMK DGIPNWDQLL KIVKEWQPDL        60
     FIVGLPLNMD DSESELSTRA RKFARRLRHQ TNIETWMVDE RLTTREAREE LGFYQEQGRA       120
     KKLSADSFAA ALLIQSWYRN PVGLTP                                            146
//

If you have problems or comments...

PBIL Back to PBIL home page