(data stored in ACNUC29543 zone)

EMBL: CP000521.PE306

CP000521.PE306       Location/Qualifiers
FT   CDS             complement(347553..348092)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0320"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0320"
FT                   /db_xref="EnsemblGenomes-Tr:ABO10784"
FT                   /protein_id="ABO10784.2"
FT                   /translation="MTHRCLIAPPEMADDFFANTVIYLARHDEEGAQGIIINRPAGIQI
FT                   KELLNDLDIDADNVNPHEVLQGGPLRPEAGFVLHTGQPTWHSSIAVGENVCITTSKDIL
FT                   DAIAHNEGVGRYQIALGYASWGKNQLEDEIARGDWLICDADMDLIFNLPYDDRWDAAYK
FT                   KIGVDRTWLASEIGHA"
     MTHRCLIAPP EMADDFFANT VIYLARHDEE GAQGIIINRP AGIQIKELLN DLDIDADNVN        60
     PHEVLQGGPL RPEAGFVLHT GQPTWHSSIA VGENVCITTS KDILDAIAHN EGVGRYQIAL       120
     GYASWGKNQL EDEIARGDWL ICDADMDLIF NLPYDDRWDA AYKKIGVDRT WLASEIGHA        179
//

If you have problems or comments...

PBIL Back to PBIL home page