(data stored in ACNUC29543 zone)

EMBL: CP000521.PE307

CP000521.PE307       Location/Qualifiers
FT   CDS             complement(348234..349901)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0321"
FT                   /product="recombination and DNA repair protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0321"
FT                   /db_xref="EnsemblGenomes-Tr:ABO10785"
FT                   /protein_id="ABO10785.2"
FT                   /translation="MLTHLTLINFALADHLAIDIEQGFNVLTGETGAGKSLLLDALSAC
FT                   LGERTDTNYVRYGSDKADVTAVFTYQDNSPEAKWLKEHELDDDSGEIHLRRVIFATGRS
FT                   KAWVNGRPSSLSELKELGRLLVQLYSQHSQQQLLEPPYPKHWLDRYSNFYAEANDVREA
FT                   YSTWQRNIRQHQAALDAQATRLQRIATLELQIEELEEIIQTDYKEIEQEFDRLSHHEHI
FT                   MQDCSYSLNALDEAEQNITQEMSSIIRRLESHAGRSEQLSEIYNSLLNAQSEIDDATSN
FT                   LRQFIDRQSFDPERMEELNSKLEVFHRLARKYRTQPETLKEEYETWQSELEQLHQLEDP
FT                   ETLAEQVEKSHQEFLEKAQHLDNIRREAAAPLAKQLTEQVKPLALPEAHFEFKFEPLEQ
FT                   PNAEGLSFIQLLFTANKGIPPQPLARVASGGELSRIALVMQVMNAEKTEAEVLVFDEID
FT                   VGISGGTAEVVGRLLADLAQHVQLLCITHQAQVAAQSDQHLLVKKQQTDPASSTIVQLD
FT                   ENQIISELARMSGGVEINETTLQHAKQLRQLKFQASST"
     MLTHLTLINF ALADHLAIDI EQGFNVLTGE TGAGKSLLLD ALSACLGERT DTNYVRYGSD        60
     KADVTAVFTY QDNSPEAKWL KEHELDDDSG EIHLRRVIFA TGRSKAWVNG RPSSLSELKE       120
     LGRLLVQLYS QHSQQQLLEP PYPKHWLDRY SNFYAEANDV REAYSTWQRN IRQHQAALDA       180
     QATRLQRIAT LELQIEELEE IIQTDYKEIE QEFDRLSHHE HIMQDCSYSL NALDEAEQNI       240
     TQEMSSIIRR LESHAGRSEQ LSEIYNSLLN AQSEIDDATS NLRQFIDRQS FDPERMEELN       300
     SKLEVFHRLA RKYRTQPETL KEEYETWQSE LEQLHQLEDP ETLAEQVEKS HQEFLEKAQH       360
     LDNIRREAAA PLAKQLTEQV KPLALPEAHF EFKFEPLEQP NAEGLSFIQL LFTANKGIPP       420
     QPLARVASGG ELSRIALVMQ VMNAEKTEAE VLVFDEIDVG ISGGTAEVVG RLLADLAQHV       480
     QLLCITHQAQ VAAQSDQHLL VKKQQTDPAS STIVQLDENQ IISELARMSG GVEINETTLQ       540
     HAKQLRQLKF QASST                                                        555
//

If you have problems or comments...

PBIL Back to PBIL home page