(data stored in ACNUC29543 zone)

EMBL: CP000521.PE308

CP000521.PE308       Location/Qualifiers
FT   CDS             350016..351326
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0322"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0322"
FT                   /db_xref="EnsemblGenomes-Tr:ABO10786"
FT                   /protein_id="ABO10786.2"
FT                   /translation="MKKTLSLPKAPIGMINRHKKTNPAEMNKILNQHFNAFKQAAAQGD
FT                   YVKAYQHVKKAVSLVPSHPGALSDLAYTELRLRRYDDAYQHYMQAIKASGSNVNTNLYD
FT                   GLTEVCHHLNKKEEKIKFGRLAISTKKELTKNEPTLNIPTHKPVPFSPNPQENIIVFSL
FT                   FGANPRYCETSILNTKLAQEIYPEWTCRFYVDESVPELVQQRLQANGAQVVHVSPTQKQ
FT                   LSGLFWRFLVMDDPVVKRFLVRDADSIVSYREKAAVDAWLKSDQWFHLMRDSYSHTELI
FT                   LAGMWGGCTGIFHNIEAHIRDYVATGRYPDNRVIDQHYLRYCIWPTLKQSVLVHDSQQF
FT                   DENSADFPVYDLTSMQNDQDNFHVGMDNGSPVVTTAVNHPTAEKVYWILFDENHDEVCR
FT                   YDAIVSKSRNIEVNLPHAFAKKIQLQQWKLQVYPYEN"
     MKKTLSLPKA PIGMINRHKK TNPAEMNKIL NQHFNAFKQA AAQGDYVKAY QHVKKAVSLV        60
     PSHPGALSDL AYTELRLRRY DDAYQHYMQA IKASGSNVNT NLYDGLTEVC HHLNKKEEKI       120
     KFGRLAISTK KELTKNEPTL NIPTHKPVPF SPNPQENIIV FSLFGANPRY CETSILNTKL       180
     AQEIYPEWTC RFYVDESVPE LVQQRLQANG AQVVHVSPTQ KQLSGLFWRF LVMDDPVVKR       240
     FLVRDADSIV SYREKAAVDA WLKSDQWFHL MRDSYSHTEL ILAGMWGGCT GIFHNIEAHI       300
     RDYVATGRYP DNRVIDQHYL RYCIWPTLKQ SVLVHDSQQF DENSADFPVY DLTSMQNDQD       360
     NFHVGMDNGS PVVTTAVNHP TAEKVYWILF DENHDEVCRY DAIVSKSRNI EVNLPHAFAK       420
     KIQLQQWKLQ VYPYEN                                                       436
//

If you have problems or comments...

PBIL Back to PBIL home page