(data stored in ACNUC29543 zone)

EMBL: CP000521.PE312

CP000521.PE312       Location/Qualifiers
FT   CDS             complement(353530..354126)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0326"
FT                   /product="dephosphocoenzyme A kinase"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0326"
FT                   /db_xref="EnsemblGenomes-Tr:ABO10790"
FT                   /protein_id="ABO10790.2"
FT                   /translation="MAFILGITGGIGSGKSAATQWFESQGIQVVDADIVAREVVEKGQP
FT                   ALQKIQQTFGDWVLQPDGSLDRRALREYIFQNPQARHTLEQITHPAIRQSIIQQLQNRK
FT                   SPYVILVSPLLFETNQHELVNHTLLIDASEQTQIQRASQRDGQNQEQIQKIIAAQMPRE
FT                   RKRELANDIVFNDGLLEHLYQQLEPLHQSYLKRAN"
     MAFILGITGG IGSGKSAATQ WFESQGIQVV DADIVAREVV EKGQPALQKI QQTFGDWVLQ        60
     PDGSLDRRAL REYIFQNPQA RHTLEQITHP AIRQSIIQQL QNRKSPYVIL VSPLLFETNQ       120
     HELVNHTLLI DASEQTQIQR ASQRDGQNQE QIQKIIAAQM PRERKRELAN DIVFNDGLLE       180
     HLYQQLEPLH QSYLKRAN                                                     198
//

If you have problems or comments...

PBIL Back to PBIL home page