(data stored in ACNUC29543 zone)

EMBL: CP000521.PE313

CP000521.PE313       Location/Qualifiers
FT   CDS             complement(354128..354988)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0327"
FT                   /product="type 4 prepilin-like proteins leader peptide
FT                   processing enzyme"
FT                   /note="Protein secretion protein XCPA"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0327"
FT                   /db_xref="EnsemblGenomes-Tr:ABO10791"
FT                   /protein_id="ABO10791.2"
FT                   /translation="MQDIIAYFIQNFTALYIAVALVSLCIGSFLNVVIYRTPKMMEQDW
FT                   QQECQMLLNPEQPIIDHEKLTLSKPASSCPACQQPIRWYQNIPVISWLVLRGKCGHCQH
FT                   PISIRYPAIELLTMLCSLVVVMVFGPTIQMLFGLVLTWVLIALTFIDFDTQLLPDRFTL
FT                   TLAALGLGINTFNIYTSPNSAIWGYLIGFLCLWIVYYLFKVITGKEGMGYGDFKLLAAL
FT                   GAWMGPLMLPLIVLLSSLLGAIIGIILLKLRNDNQPFAFGPYIAIAGWVAFLWGDQIMK
FT                   IYLGG"
     MQDIIAYFIQ NFTALYIAVA LVSLCIGSFL NVVIYRTPKM MEQDWQQECQ MLLNPEQPII        60
     DHEKLTLSKP ASSCPACQQP IRWYQNIPVI SWLVLRGKCG HCQHPISIRY PAIELLTMLC       120
     SLVVVMVFGP TIQMLFGLVL TWVLIALTFI DFDTQLLPDR FTLTLAALGL GINTFNIYTS       180
     PNSAIWGYLI GFLCLWIVYY LFKVITGKEG MGYGDFKLLA ALGAWMGPLM LPLIVLLSSL       240
     LGAIIGIILL KLRNDNQPFA FGPYIAIAGW VAFLWGDQIM KIYLGG                      286
//

If you have problems or comments...

PBIL Back to PBIL home page