(data stored in ACNUC29543 zone)

EMBL: CP000521.PE315

CP000521.PE315       Location/Qualifiers
FT   CDS             complement(356244..357956)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0329"
FT                   /product="type 4 fimbrial biogenesis protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0329"
FT                   /db_xref="EnsemblGenomes-Tr:ABO10793"
FT                   /protein_id="ABO10793.2"
FT                   /translation="MSALHTSPKFTGFFRRLVEEKHVSAATMQTALDAAKRAKQDTVAY
FT                   LIEEVHLSPSLLAETISAEFAEPYFDLDVYDTSQIPKDLVDQKLILKHRILPLIQRGQI
FT                   LYVATSNPSNIEAIDAIRFNSKLLVEPVIVEHHKLEKVLGQHFAEESSFDFNDEEFDLD
FT                   VNLDGPTAQDDEEEAPQGDEAPIVKYINKLLIDAIRMGASDLHFEPYEKSYRVRYRVDG
FT                   VLRQIANPPLQLANRLASRLKVMSQMDISEKRVPQDGRIKLKLSKSKAIDFRVNSLPTL
FT                   FGEKLVLRILDPSSAMLGIDALGYEEDQKALFMEALDKPQGMLLITGPTGSGKTVSLYT
FT                   GLNILNTESSNISTAEDPVEINLEGINQVNVNPKVGLTFAAALKSFLRQDPDIIMVGEI
FT                   RDLETAEIAIKAAQTGHMVMSTLHTNSAPETLTRLRNMGVPSFNIATSVNLVIAQRLAR
FT                   RLCSQCKIPADIPKQSLLEMGFTEQDLAHPDFRVFQPVGCPECREGYKGRVGIYEVMKV
FT                   TPEISKIIMEDGNALEIAAASEKLGFNNLRRSGLKKVMQGVTSLQEVNRVTSE"
     MSALHTSPKF TGFFRRLVEE KHVSAATMQT ALDAAKRAKQ DTVAYLIEEV HLSPSLLAET        60
     ISAEFAEPYF DLDVYDTSQI PKDLVDQKLI LKHRILPLIQ RGQILYVATS NPSNIEAIDA       120
     IRFNSKLLVE PVIVEHHKLE KVLGQHFAEE SSFDFNDEEF DLDVNLDGPT AQDDEEEAPQ       180
     GDEAPIVKYI NKLLIDAIRM GASDLHFEPY EKSYRVRYRV DGVLRQIANP PLQLANRLAS       240
     RLKVMSQMDI SEKRVPQDGR IKLKLSKSKA IDFRVNSLPT LFGEKLVLRI LDPSSAMLGI       300
     DALGYEEDQK ALFMEALDKP QGMLLITGPT GSGKTVSLYT GLNILNTESS NISTAEDPVE       360
     INLEGINQVN VNPKVGLTFA AALKSFLRQD PDIIMVGEIR DLETAEIAIK AAQTGHMVMS       420
     TLHTNSAPET LTRLRNMGVP SFNIATSVNL VIAQRLARRL CSQCKIPADI PKQSLLEMGF       480
     TEQDLAHPDF RVFQPVGCPE CREGYKGRVG IYEVMKVTPE ISKIIMEDGN ALEIAAASEK       540
     LGFNNLRRSG LKKVMQGVTS LQEVNRVTSE                                        570
//

If you have problems or comments...

PBIL Back to PBIL home page