(data stored in ACNUC29543 zone)

EMBL: CP000521.PE318

CP000521.PE318       Location/Qualifiers
FT   CDS             359859..360383
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0334"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0334"
FT                   /db_xref="EnsemblGenomes-Tr:ABO10796"
FT                   /db_xref="GOA:A3M1K2"
FT                   /db_xref="InterPro:IPR003728"
FT                   /db_xref="InterPro:IPR028989"
FT                   /db_xref="InterPro:IPR028998"
FT                   /db_xref="InterPro:IPR035956"
FT                   /db_xref="InterPro:IPR036847"
FT                   /db_xref="UniProtKB/Swiss-Prot:A3M1K2"
FT                   /protein_id="ABO10796.2"
FT                   /translation="MKLSNKSQALYDMIAPAVEACGVDLWGIEFLPQGKRSLLRIYIDR
FT                   PVDENAEPVINEDGEVEQGRGIGVEDCVRVTQQVGAMLDVHDPISGEYALEVSSPGWDR
FT                   PFFQLEQLQGYIGQQVALRLIAAVENRRKFQAKLLAVDLENEEIQVEVEGKHVLDIDSN
FT                   NIDKANLIYQD"
     MKLSNKSQAL YDMIAPAVEA CGVDLWGIEF LPQGKRSLLR IYIDRPVDEN AEPVINEDGE        60
     VEQGRGIGVE DCVRVTQQVG AMLDVHDPIS GEYALEVSSP GWDRPFFQLE QLQGYIGQQV       120
     ALRLIAAVEN RRKFQAKLLA VDLENEEIQV EVEGKHVLDI DSNNIDKANL IYQD             174
//

If you have problems or comments...

PBIL Back to PBIL home page