(data stored in ACNUC29543 zone)

EMBL: CP000521.PE319

CP000521.PE319       Location/Qualifiers
FT   CDS             360421..361905
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0335"
FT                   /product="transcription termination/antitermination L
FT                   factor"
FT                   /note="N utilization substance protein A"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0335"
FT                   /db_xref="EnsemblGenomes-Tr:ABO10797"
FT                   /protein_id="ABO10797.2"
FT                   /translation="MGREILTVVETVSNEKGVSREAIFEALEQALVAATKKKFYEGTNS
FT                   EEAQLRVEIDRRTGDYRTFRQWTVVADEDHEMPACQDAISDVDPAKWSIGDVRELEVES
FT                   IEFGRIAAQIAKQVIVQKIREAERALVADAYESKVGELIYGEVKKQTKDGFIIDLGDNA
FT                   EAYLAREEMIPKEILRPKQRVNAILYSVNREGRGAQLLLSRAKPEMLIALMKKEIPEIS
FT                   EEIIEIKAAARQPGVRAKIAVKTNDHRIDPVGACIGMRGTRIQAVQQELNGERIDVVVW
FT                   SDDPAQYIASALEPADVSGIVLDEDAKSADIIFATNDQLARAIGSQGQNVRLASDLTGY
FT                   KLDMMLEEEYRARQQNEAQQYLDMFVSRLDIEEDLAMALVEMGFTSLEEIAYVPAETFD
FT                   EIELDAELVELLQSRAKEAALTDALKQQENIQEPSADLLNMEGMTSEIAYSLAARGIIT
FT                   VDDLADQATDDISDIEGLGHEKAGQLIMKARESWFN"
     MGREILTVVE TVSNEKGVSR EAIFEALEQA LVAATKKKFY EGTNSEEAQL RVEIDRRTGD        60
     YRTFRQWTVV ADEDHEMPAC QDAISDVDPA KWSIGDVREL EVESIEFGRI AAQIAKQVIV       120
     QKIREAERAL VADAYESKVG ELIYGEVKKQ TKDGFIIDLG DNAEAYLARE EMIPKEILRP       180
     KQRVNAILYS VNREGRGAQL LLSRAKPEML IALMKKEIPE ISEEIIEIKA AARQPGVRAK       240
     IAVKTNDHRI DPVGACIGMR GTRIQAVQQE LNGERIDVVV WSDDPAQYIA SALEPADVSG       300
     IVLDEDAKSA DIIFATNDQL ARAIGSQGQN VRLASDLTGY KLDMMLEEEY RARQQNEAQQ       360
     YLDMFVSRLD IEEDLAMALV EMGFTSLEEI AYVPAETFDE IELDAELVEL LQSRAKEAAL       420
     TDALKQQENI QEPSADLLNM EGMTSEIAYS LAARGIITVD DLADQATDDI SDIEGLGHEK       480
     AGQLIMKARE SWFN                                                         494
//

If you have problems or comments...

PBIL Back to PBIL home page