(data stored in ACNUC29543 zone)

EMBL: CP000521.PE32

CP000521.PE32        Location/Qualifiers
FT   CDS             complement(40146..40466)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0032"
FT                   /product="putative signal peptide"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0032"
FT                   /db_xref="EnsemblGenomes-Tr:ABO10527"
FT                   /protein_id="ABO10527.2"
FT                   /translation="MKKITTAIILSMSGLIATTAMAAPHDHYHHQGYETKTVKVIHKDD
FT                   HANIWRAGQVVPHQYQHPRYVIDYRSHQKLTKPGRYQKWYKVNGNYVLVNEQSHKIIKV
FT                   IR"
     MKKITTAIIL SMSGLIATTA MAAPHDHYHH QGYETKTVKV IHKDDHANIW RAGQVVPHQY        60
     QHPRYVIDYR SHQKLTKPGR YQKWYKVNGN YVLVNEQSHK IIKVIR                      106
//

If you have problems or comments...

PBIL Back to PBIL home page