(data stored in ACNUC29543 zone)

EMBL: CP000521.PE322

CP000521.PE322       Location/Qualifiers
FT   CDS             complement(365761..366288)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0340"
FT                   /product="pH adaptation potassium efflux system E
FT                   transmembrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0340"
FT                   /db_xref="EnsemblGenomes-Tr:ABO10800"
FT                   /protein_id="ABO10800.2"
FT                   /translation="MQLSKLLDRWFPHPFVSFLIIIFWLMLAHSLDASDLLMAVVLGLV
FT                   IPRLVRPFITRTPHIHWKPAIKLCFVVLWDIIVSNFRVAKLVLGSPKKLHPKWYRVPLE
FT                   TEHEQVNSLLAMIITTTPGTVSAGIDQERGDILVHSLSTENTESDVQDIKQRYEAPLME
FT                   IFDVKSKSEDNA"
     MQLSKLLDRW FPHPFVSFLI IIFWLMLAHS LDASDLLMAV VLGLVIPRLV RPFITRTPHI        60
     HWKPAIKLCF VVLWDIIVSN FRVAKLVLGS PKKLHPKWYR VPLETEHEQV NSLLAMIITT       120
     TPGTVSAGID QERGDILVHS LSTENTESDV QDIKQRYEAP LMEIFDVKSK SEDNA            175
//

If you have problems or comments...

PBIL Back to PBIL home page