(data stored in ACNUC29543 zone)

EMBL: CP000521.PE325

CP000521.PE325       Location/Qualifiers
FT   CDS             complement(368467..371316)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0343"
FT                   /product="pH adaptation potassium efflux system
FT                   transmembrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0343"
FT                   /db_xref="EnsemblGenomes-Tr:ABO10803"
FT                   /protein_id="ABO10803.2"
FT                   /translation="MDTSVLPIIILLPLILGTTLVSLLQRFSRGVTALGAIGVSLTSFG
FT                   LLLTQAKTVLGGASIQQSWDWLPQLGINLSFRLDALGLLFSLLITGIGTLIYIYAYYYL
FT                   GPKNSLSKLYLLLMLFMAAMLGISLSNNLIILLVFWELTSISSFLLVGYWSHYEAAQRG
FT                   SRMALTITGMGGLAMLGGFVLLGQITGTYEINDIVGMKDLIQSHYLFVPTLLLILLGTF
FT                   TKSAQFPFHFWLPNAMAAPTPVSAYLHSATMVKAGIFLLARLAPIFIGAALYHNIVTFV
FT                   GLFTLCMAACFAIFKEDLKGLLAYSTISHLGLIVCLLGIGSPLAVAAAIFHIINHATFK
FT                   AALFMIAGIIDHETGTRDLRKLSGIWQLLPFTATLTMITAASMAGVPLTNGFISKEMFF
FT                   TELLASLSGSTVIFASIIATLAGIFAVSYSIRLVHGVFFDGPVGKQVPNKNAHEPPIGM
FT                   RAPAILLATLCILVGIFPALLVEPLVNSVTRASLMQPDFAGTHLAIWHGFNAPLIMSII
FT                   ALVGGTLFYFALAKDGMIRKIDLDPRLGRLQGRILFDLFLKHLLLTSRKIKQKTENGSL
FT                   QSYLFLIIAFSIVMVTLPLFNQGLTTGTRELTHAPWIAVVLWLTLFSGCWMMLWFHHER
FT                   IKAVLISGAIGLVVTMVFVTMSAPDLALTQITVDVVTTVLLLMSLSLLPQLTPYESRRS
FT                   RRWRDAALAIIGGLGIGWITWLILTRDHNSISWFFAQQSLPLGGGSNIVNVILVDFRGF
FT                   DTFGEITVLGIAAIGALCLMDGMRVHGTTMTQGLTYRFNPSPLMFRITASWVLPLALVV
FT                   SVYIFMRGHNYPGGGFIAGLITSMALIIQYIALGQDQAEQMLKAQSGRLYEIWIGSGLT
FT                   IAGLTGIAAWFWARPFLTSAHVYVELPVLGKLHLASAASFDLGVYITVVGATMLLISVL
FT                   GDSRHSSMSGPVPHGEKSS"
     MDTSVLPIII LLPLILGTTL VSLLQRFSRG VTALGAIGVS LTSFGLLLTQ AKTVLGGASI        60
     QQSWDWLPQL GINLSFRLDA LGLLFSLLIT GIGTLIYIYA YYYLGPKNSL SKLYLLLMLF       120
     MAAMLGISLS NNLIILLVFW ELTSISSFLL VGYWSHYEAA QRGSRMALTI TGMGGLAMLG       180
     GFVLLGQITG TYEINDIVGM KDLIQSHYLF VPTLLLILLG TFTKSAQFPF HFWLPNAMAA       240
     PTPVSAYLHS ATMVKAGIFL LARLAPIFIG AALYHNIVTF VGLFTLCMAA CFAIFKEDLK       300
     GLLAYSTISH LGLIVCLLGI GSPLAVAAAI FHIINHATFK AALFMIAGII DHETGTRDLR       360
     KLSGIWQLLP FTATLTMITA ASMAGVPLTN GFISKEMFFT ELLASLSGST VIFASIIATL       420
     AGIFAVSYSI RLVHGVFFDG PVGKQVPNKN AHEPPIGMRA PAILLATLCI LVGIFPALLV       480
     EPLVNSVTRA SLMQPDFAGT HLAIWHGFNA PLIMSIIALV GGTLFYFALA KDGMIRKIDL       540
     DPRLGRLQGR ILFDLFLKHL LLTSRKIKQK TENGSLQSYL FLIIAFSIVM VTLPLFNQGL       600
     TTGTRELTHA PWIAVVLWLT LFSGCWMMLW FHHERIKAVL ISGAIGLVVT MVFVTMSAPD       660
     LALTQITVDV VTTVLLLMSL SLLPQLTPYE SRRSRRWRDA ALAIIGGLGI GWITWLILTR       720
     DHNSISWFFA QQSLPLGGGS NIVNVILVDF RGFDTFGEIT VLGIAAIGAL CLMDGMRVHG       780
     TTMTQGLTYR FNPSPLMFRI TASWVLPLAL VVSVYIFMRG HNYPGGGFIA GLITSMALII       840
     QYIALGQDQA EQMLKAQSGR LYEIWIGSGL TIAGLTGIAA WFWARPFLTS AHVYVELPVL       900
     GKLHLASAAS FDLGVYITVV GATMLLISVL GDSRHSSMSG PVPHGEKSS                   949
//

If you have problems or comments...

PBIL Back to PBIL home page