(data stored in ACNUC29543 zone)

EMBL: CP000521.PE328

CP000521.PE328       Location/Qualifiers
FT   CDS             complement(374549..375322)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0346"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0346"
FT                   /db_xref="EnsemblGenomes-Tr:ABO10806"
FT                   /protein_id="ABO10806.2"
FT                   /translation="MNNTQWLDEVKFNEQGLIPAIAQHHQTGRILMVAWMNRESLALTA
FT                   EKNQAVYFSRSRQKLWHKGEESGHFQTVYEIRLDCDGDVIVLQVEQHGGIACHTGRESC
FT                   FYRKLTPQGWEIVDAQLKDPTAIYGDNAKTESHDHAHTTEQVDVLAHLGQLMQERKQAE
FT                   ADTSYVASLYKKGINKILEKVGEEGVETIIAAKDYATQNTESNLNDLIYETADLWFHSI
FT                   VMLGYFDLNPQLIIDELGRRQGLSGLVEKANRNKV"
     MNNTQWLDEV KFNEQGLIPA IAQHHQTGRI LMVAWMNRES LALTAEKNQA VYFSRSRQKL        60
     WHKGEESGHF QTVYEIRLDC DGDVIVLQVE QHGGIACHTG RESCFYRKLT PQGWEIVDAQ       120
     LKDPTAIYGD NAKTESHDHA HTTEQVDVLA HLGQLMQERK QAEADTSYVA SLYKKGINKI       180
     LEKVGEEGVE TIIAAKDYAT QNTESNLNDL IYETADLWFH SIVMLGYFDL NPQLIIDELG       240
     RRQGLSGLVE KANRNKV                                                      257
//

If you have problems or comments...

PBIL Back to PBIL home page