(data stored in ACNUC29543 zone)

EMBL: CP000521.PE331

CP000521.PE331       Location/Qualifiers
FT   CDS             complement(378546..379214)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0349"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0349"
FT                   /db_xref="EnsemblGenomes-Tr:ABO10809"
FT                   /protein_id="ABO10809.2"
FT                   /translation="MWSILALGAVERIIHHLIDLDALTRIQLNQLQGKMLRVIIDSPQL
FT                   SVDVFFDQEKVRLEPTVTGHSEKPSIFEQRPFDPQFKISEATATLHVKDVVELIKLLLS
FT                   DPDQIGNIPLQGDYHLLQDIQKIMQQAEPDLAAHLSKWVGPQLAHEIGKIQLAPKHLKR
FT                   SLQSHLFFAEDALKEDSGLFAPRWEMDDLNQATRKLNQDIDRLEAKLQQLNAQLQPTQD
FT                   "
     MWSILALGAV ERIIHHLIDL DALTRIQLNQ LQGKMLRVII DSPQLSVDVF FDQEKVRLEP        60
     TVTGHSEKPS IFEQRPFDPQ FKISEATATL HVKDVVELIK LLLSDPDQIG NIPLQGDYHL       120
     LQDIQKIMQQ AEPDLAAHLS KWVGPQLAHE IGKIQLAPKH LKRSLQSHLF FAEDALKEDS       180
     GLFAPRWEMD DLNQATRKLN QDIDRLEAKL QQLNAQLQPT QD                          222
//

If you have problems or comments...

PBIL Back to PBIL home page