(data stored in ACNUC29543 zone)

EMBL: CP000521.PE335

CP000521.PE335       Location/Qualifiers
FT   CDS             complement(382677..383183)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0353"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0353"
FT                   /db_xref="EnsemblGenomes-Tr:ABO10813"
FT                   /protein_id="ABO10813.2"
FT                   /translation="MKIDNIPDYIDPSLNLEQIRDECQELIQKRAYVSAGAAIVPIPFF
FT                   DVVVDLGILSQLIPDINSRFGLAPEHVSVYDPKTKTIHWDELRKRGFQFSGFVVARTTV
FT                   KKTFNGFFGKIVTKQVTKFVPLGGQLVAASLGYFMMKKIAQTHLNDSYNLAKRIQQKSR
FT                   GTVVN"
     MKIDNIPDYI DPSLNLEQIR DECQELIQKR AYVSAGAAIV PIPFFDVVVD LGILSQLIPD        60
     INSRFGLAPE HVSVYDPKTK TIHWDELRKR GFQFSGFVVA RTTVKKTFNG FFGKIVTKQV       120
     TKFVPLGGQL VAASLGYFMM KKIAQTHLND SYNLAKRIQQ KSRGTVVN                    168
//

If you have problems or comments...

PBIL Back to PBIL home page