(data stored in ACNUC29543 zone)

EMBL: CP000521.PE342

CP000521.PE342       Location/Qualifiers
FT   CDS             394780..395049
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0360"
FT                   /product="30S ribosomal protein S15"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0360"
FT                   /db_xref="EnsemblGenomes-Tr:ABO10820"
FT                   /db_xref="GOA:A3M1M6"
FT                   /db_xref="InterPro:IPR000589"
FT                   /db_xref="InterPro:IPR005290"
FT                   /db_xref="InterPro:IPR009068"
FT                   /db_xref="UniProtKB/Swiss-Prot:A3M1M6"
FT                   /protein_id="ABO10820.1"
FT                   /translation="MALTNADRAEIIAKFARAENDTGSPEVQVALLTAQINDLQGHFKA
FT                   HKHDHHSRRGLIRMVNQRRKLLDYLNGKDHERYTALIGALGLRR"
     MALTNADRAE IIAKFARAEN DTGSPEVQVA LLTAQINDLQ GHFKAHKHDH HSRRGLIRMV        60
     NQRRKLLDYL NGKDHERYTA LIGALGLRR                                          89
//

If you have problems or comments...

PBIL Back to PBIL home page