(data stored in ACNUC29543 zone)

EMBL: CP000521.PE347

CP000521.PE347       Location/Qualifiers
FT   CDS             complement(400385..400996)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0365"
FT                   /product="putative amino-acid efflux transmembrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0365"
FT                   /db_xref="EnsemblGenomes-Tr:ABO10825"
FT                   /protein_id="ABO10825.2"
FT                   /translation="MNYFDYFLFIFSVIIMIATPGPVMILVASVGLKGGYKKALETIFG
FT                   TNLASLVLIFISVLVLKGVLGINENYLNIIRVLGCLYIGYLGFSILKEVIQAPHPEAIQ
FT                   TVSAQNGGFKKGFLVGISNPKDIIFFSAFFPQFVSISPHLDLSLTILTLTWIVLDFLTL
FT                   SLVYIFFRRLSNSHLYPKILGLCGLLLLVIAVYGLYQTFT"
     MNYFDYFLFI FSVIIMIATP GPVMILVASV GLKGGYKKAL ETIFGTNLAS LVLIFISVLV        60
     LKGVLGINEN YLNIIRVLGC LYIGYLGFSI LKEVIQAPHP EAIQTVSAQN GGFKKGFLVG       120
     ISNPKDIIFF SAFFPQFVSI SPHLDLSLTI LTLTWIVLDF LTLSLVYIFF RRLSNSHLYP       180
     KILGLCGLLL LVIAVYGLYQ TFT                                               203
//

If you have problems or comments...

PBIL Back to PBIL home page