(data stored in ACNUC29543 zone)

EMBL: CP000521.PE349

CP000521.PE349       Location/Qualifiers
FT   CDS             complement(402175..404016)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0367"
FT                   /product="glutathione-regulated potassium-efflux system
FT                   protein (K(+)/H(+) antiporter)"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0367"
FT                   /db_xref="EnsemblGenomes-Tr:ABO10827"
FT                   /protein_id="ABO10827.2"
FT                   /translation="MSFLLQATIFLGASLILVPLGKRLGIATVLGYLFTGILLGPSVLN
FT                   IAHDPEAIMELAEFGVILLMFLIGLELRPQRLWEMRDSIFVMGSLQVVITGIILMLTVL
FT                   LLFQQHLAASFVIGFALALSSTAFVLQLLTEKQQLNTTYGQQSFSILLFQDIAAIPLLA
FT                   VIPLLAGTESTHHGIAYFAAIIATFTGLFLFSRYVMRPFFRFVAKSGATELITAVGLFI
FT                   ILAVVLLMDTLGISTTLGAFLTGVLLADSEFRHELEASIAPFKGLLLGLFFMTVGMTTQ
FT                   LSLLIEMPWLIIGGAIGLLVIKTLVLTAIARYKKYSWNNSLLLGTCLAQGGEFAFVILS
FT                   LAKSEKILTDALLEPVTLIVTLSMVLTPVIYWIMACKIIPLFHKELPPEYDEIPQQDNP
FT                   IIIAGFGRFGQIIARIARLQHLGFTAIDNNLHQVDFVRRYGGKLYYGDVTQPDLLRSAG
FT                   IEKAKVFILAIDDVEDSMNVARHLRLNYPNLKLLARARDRHHVHLLRDLGVEHIWRETY
FT                   LSSLGMAYRALRELGISDEQAYNNIEIFRDYDEKLLIQQQSIYTDEQKVFETHRNALAE
FT                   LEHLFESDAQQATSKHDVNLKRHLQPNRIDITRDHEE"
     MSFLLQATIF LGASLILVPL GKRLGIATVL GYLFTGILLG PSVLNIAHDP EAIMELAEFG        60
     VILLMFLIGL ELRPQRLWEM RDSIFVMGSL QVVITGIILM LTVLLLFQQH LAASFVIGFA       120
     LALSSTAFVL QLLTEKQQLN TTYGQQSFSI LLFQDIAAIP LLAVIPLLAG TESTHHGIAY       180
     FAAIIATFTG LFLFSRYVMR PFFRFVAKSG ATELITAVGL FIILAVVLLM DTLGISTTLG       240
     AFLTGVLLAD SEFRHELEAS IAPFKGLLLG LFFMTVGMTT QLSLLIEMPW LIIGGAIGLL       300
     VIKTLVLTAI ARYKKYSWNN SLLLGTCLAQ GGEFAFVILS LAKSEKILTD ALLEPVTLIV       360
     TLSMVLTPVI YWIMACKIIP LFHKELPPEY DEIPQQDNPI IIAGFGRFGQ IIARIARLQH       420
     LGFTAIDNNL HQVDFVRRYG GKLYYGDVTQ PDLLRSAGIE KAKVFILAID DVEDSMNVAR       480
     HLRLNYPNLK LLARARDRHH VHLLRDLGVE HIWRETYLSS LGMAYRALRE LGISDEQAYN       540
     NIEIFRDYDE KLLIQQQSIY TDEQKVFETH RNALAELEHL FESDAQQATS KHDVNLKRHL       600
     QPNRIDITRD HEE                                                          613
//

If you have problems or comments...

PBIL Back to PBIL home page