(data stored in ACNUC29543 zone)

EMBL: CP000521.PE350

CP000521.PE350       Location/Qualifiers
FT   CDS             complement(404093..406321)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0368"
FT                   /product="ATP-dependent primosomal protein N'"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0368"
FT                   /db_xref="EnsemblGenomes-Tr:ABO10828"
FT                   /protein_id="ABO10828.2"
FT                   /translation="MTITPKPDSVVYRVRVAVPVHLYDTFDYTLTKAQYERAQVGSRVA
FT                   ISFGRQNLIGIITEKVDPQETFTGHFQLKAISELLDDEPILDEQVLNLLTWSAQYYQFP
FT                   IGEVMQTALPALLRQGKPMDVLFHLWKIIPCDNAEALLKRSIKQQDAYQILKLHPAGTT
FT                   ENILNLSGVETATLKALQKKGLVDCTLEPHDFSPSSVQLAQMPLTLNEDQKKATQHVLN
FT                   AQHQYQAFLLDGLTGSGKTEVYLHIMHEVLKQGKQVLVLVPEIGLTPQTISRFKSRFNC
FT                   DIALLHSGLNDSKRLQAWQQAQTGKASIILGTRSAIYTPLPRLGLIILDEEHDLSYKQQ
FT                   EGFRYHARDVALYRGHLQGCPVLLGSATPSIDSYHLVETGKLTALQLNQRAGHALLPKM
FT                   HLIDLKIVKKQHGISQPLIEQIKNTLARKEQVLIFLNRRGYAPVLVCESCGWQANCPHC
FT                   DAHFTLHTQPYSYLHCHHCGTVHRLPDHCPECQQKSLKTLGAGTAKVEEHLQELFPDHD
FT                   VIRVDRDSTSRVGSWQKIYDRIQQNKPSILLGTQMLAKGHHFPHVTLVAILDIDAGLLS
FT                   VDIRAPERTAQLIVQVAGRAGRGEHKGHVYLQTLRPDHPLLTTLIEKDYRAVAKQTLAE
FT                   RKVALLPPYRYTVLIRAESKDRDYTLHFLNEAAEQLRQIAGDIVDIWGPIPAPMERKAG
FT                   RYRAHMVILSADRARLHFYLRQWWAQLVHAPRQHQLRLSIDVDPQEFS"
     MTITPKPDSV VYRVRVAVPV HLYDTFDYTL TKAQYERAQV GSRVAISFGR QNLIGIITEK        60
     VDPQETFTGH FQLKAISELL DDEPILDEQV LNLLTWSAQY YQFPIGEVMQ TALPALLRQG       120
     KPMDVLFHLW KIIPCDNAEA LLKRSIKQQD AYQILKLHPA GTTENILNLS GVETATLKAL       180
     QKKGLVDCTL EPHDFSPSSV QLAQMPLTLN EDQKKATQHV LNAQHQYQAF LLDGLTGSGK       240
     TEVYLHIMHE VLKQGKQVLV LVPEIGLTPQ TISRFKSRFN CDIALLHSGL NDSKRLQAWQ       300
     QAQTGKASII LGTRSAIYTP LPRLGLIILD EEHDLSYKQQ EGFRYHARDV ALYRGHLQGC       360
     PVLLGSATPS IDSYHLVETG KLTALQLNQR AGHALLPKMH LIDLKIVKKQ HGISQPLIEQ       420
     IKNTLARKEQ VLIFLNRRGY APVLVCESCG WQANCPHCDA HFTLHTQPYS YLHCHHCGTV       480
     HRLPDHCPEC QQKSLKTLGA GTAKVEEHLQ ELFPDHDVIR VDRDSTSRVG SWQKIYDRIQ       540
     QNKPSILLGT QMLAKGHHFP HVTLVAILDI DAGLLSVDIR APERTAQLIV QVAGRAGRGE       600
     HKGHVYLQTL RPDHPLLTTL IEKDYRAVAK QTLAERKVAL LPPYRYTVLI RAESKDRDYT       660
     LHFLNEAAEQ LRQIAGDIVD IWGPIPAPME RKAGRYRAHM VILSADRARL HFYLRQWWAQ       720
     LVHAPRQHQL RLSIDVDPQE FS                                                742
//

If you have problems or comments...

PBIL Back to PBIL home page