(data stored in ACNUC29543 zone)

EMBL: CP000521.PE351

CP000521.PE351       Location/Qualifiers
FT   CDS             406470..407675
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0369"
FT                   /product="general secretion pathway protein F"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0369"
FT                   /db_xref="EnsemblGenomes-Tr:ABO10829"
FT                   /protein_id="ABO10829.2"
FT                   /translation="MPAYQFTAIDASGKQQKGVLEGDSARQIRQQLRDKAWTPISVDPV
FT                   EQKDKHQSHGLFQKKFSAYDLALMTRQLSVLVAAAIPLEEALRAVSRQSEKAHVQNLLL
FT                   SVRSKVLEGHSLAQGMQQSGRFPDLYIATVAAGERSGHLDLILDQLSDYTENRFAMQKK
FT                   VQGAMIYPIILMLMSFGIVMGLMTYVVPEIVKTFDQSKDALPWITVALMKASDFIRHAW
FT                   VFIILFAIVGVVAFVRFLKTTAGHYAFDRLTLKLPLFGKLSRGINAARFASTLSILTRS
FT                   GVPLVDALKIGAAVTNNWVIRDSISQAAERVTEGGNLGTQLERSGYFPPMMVQMIRSGE
FT                   ASGELDRMLERASTMQDREVTTFISTLLALLEPLMLVLMASIVLVIVIAVMLPIVNMNN
FT                   MI"
     MPAYQFTAID ASGKQQKGVL EGDSARQIRQ QLRDKAWTPI SVDPVEQKDK HQSHGLFQKK        60
     FSAYDLALMT RQLSVLVAAA IPLEEALRAV SRQSEKAHVQ NLLLSVRSKV LEGHSLAQGM       120
     QQSGRFPDLY IATVAAGERS GHLDLILDQL SDYTENRFAM QKKVQGAMIY PIILMLMSFG       180
     IVMGLMTYVV PEIVKTFDQS KDALPWITVA LMKASDFIRH AWVFIILFAI VGVVAFVRFL       240
     KTTAGHYAFD RLTLKLPLFG KLSRGINAAR FASTLSILTR SGVPLVDALK IGAAVTNNWV       300
     IRDSISQAAE RVTEGGNLGT QLERSGYFPP MMVQMIRSGE ASGELDRMLE RASTMQDREV       360
     TTFISTLLAL LEPLMLVLMA SIVLVIVIAV MLPIVNMNNM I                           401
//

If you have problems or comments...

PBIL Back to PBIL home page