(data stored in ACNUC29543 zone)

EMBL: CP000521.PE352

CP000521.PE352       Location/Qualifiers
FT   CDS             407699..408280
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0370"
FT                   /product="general secretion pathway protein G"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0370"
FT                   /db_xref="EnsemblGenomes-Tr:ABO10830"
FT                   /protein_id="ABO10830.2"
FT                   /translation="MKVKNIQSEIAMKQHSESVVSNQFEPTCHSEHSSVSDVCSSSAFG
FT                   LATRSSRARMKRVSGFTLIEVMVVIVILGVLAALIVPNVMGRSEKAKIDTTQITLKGVA
FT                   GALDQYKLDNGHFPTMQEGGLDALINQPATAKNWMPGGYVKGGYPKDSWKNDIQYVVPG
FT                   KDGHPFDLYSFGADGKEGGEGNDADIYYQP"
     MKVKNIQSEI AMKQHSESVV SNQFEPTCHS EHSSVSDVCS SSAFGLATRS SRARMKRVSG        60
     FTLIEVMVVI VILGVLAALI VPNVMGRSEK AKIDTTQITL KGVAGALDQY KLDNGHFPTM       120
     QEGGLDALIN QPATAKNWMP GGYVKGGYPK DSWKNDIQYV VPGKDGHPFD LYSFGADGKE       180
     GGEGNDADIY YQP                                                          193
//

If you have problems or comments...

PBIL Back to PBIL home page