(data stored in ACNUC29543 zone)

EMBL: CP000521.PE353

CP000521.PE353       Location/Qualifiers
FT   CDS             408547..408891
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0371"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0371"
FT                   /db_xref="EnsemblGenomes-Tr:ABO10831"
FT                   /protein_id="ABO10831.2"
FT                   /translation="MKAFLVLDELNQFHWAMLKSVLLILALLPIAEVSLKLWLSTEGSS
FT                   QIMIGFFALSIVSAWLMVSFFTALKTSVWQTKQMASKYEQLLFKAYRYVPMVFLSSLVA
FT                   YLSLQLSIAF"
     MKAFLVLDEL NQFHWAMLKS VLLILALLPI AEVSLKLWLS TEGSSQIMIG FFALSIVSAW        60
     LMVSFFTALK TSVWQTKQMA SKYEQLLFKA YRYVPMVFLS SLVAYLSLQL SIAF             114
//

If you have problems or comments...

PBIL Back to PBIL home page