(data stored in ACNUC29543 zone)

EMBL: CP000521.PE356

CP000521.PE356       Location/Qualifiers
FT   CDS             complement(410695..410934)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0374"
FT                   /product="apolipoprotein N-acyltransferase copper
FT                   homeostasis protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0374"
FT                   /db_xref="EnsemblGenomes-Tr:ABO10834"
FT                   /protein_id="ABO10834.1"
FT                   /translation="MRAYFEKLLDSSQQQKQLPLIFHCSLLYFQVPCSVLHWHLIIGGG
FT                   WQFCLQPYSMRHCITAQPNKHLQLAGVMVLVYGL"
     MRAYFEKLLD SSQQQKQLPL IFHCSLLYFQ VPCSVLHWHL IIGGGWQFCL QPYSMRHCIT        60
     AQPNKHLQLA GVMVLVYGL                                                     79
//

If you have problems or comments...

PBIL Back to PBIL home page