(data stored in ACNUC29543 zone)

EMBL: CP000521.PE357

CP000521.PE357       Location/Qualifiers
FT   CDS             complement(410931..411770)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0375"
FT                   /product="magnesium and cobalt efflux protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0375"
FT                   /db_xref="EnsemblGenomes-Tr:ABO10835"
FT                   /protein_id="ABO10835.2"
FT                   /translation="MQEEPSPSWGMRGLRKWLGTAPETRDELLKLVQNSRRFLEPDTVA
FT                   MLEGVLDLPATKIREVMTPRTAMISMQEDDQLLDILHVLVESAHSRFPVFSADQPDNVV
FT                   GILLAKDLLPFLTEPNTKLDIGSLMRQPLFVPESARSDQVLRMLKHTQTHIAIVIDEYG
FT                   STAGLVTLEDILEEIVGEIEDEHDTADEDAQYIVPDNDHTIANAWMVQALTPIEHFNTV
FT                   LDADFSDDEVETVGGLLLQEIGLVSDLQGQTVELGNWLFTIVEADARTIHLIRAVRQ"
     MQEEPSPSWG MRGLRKWLGT APETRDELLK LVQNSRRFLE PDTVAMLEGV LDLPATKIRE        60
     VMTPRTAMIS MQEDDQLLDI LHVLVESAHS RFPVFSADQP DNVVGILLAK DLLPFLTEPN       120
     TKLDIGSLMR QPLFVPESAR SDQVLRMLKH TQTHIAIVID EYGSTAGLVT LEDILEEIVG       180
     EIEDEHDTAD EDAQYIVPDN DHTIANAWMV QALTPIEHFN TVLDADFSDD EVETVGGLLL       240
     QEIGLVSDLQ GQTVELGNWL FTIVEADART IHLIRAVRQ                              279
//

If you have problems or comments...

PBIL Back to PBIL home page