(data stored in ACNUC29543 zone)

EMBL: CP000521.PE358

CP000521.PE358       Location/Qualifiers
FT   CDS             411955..412212
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0376"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0376"
FT                   /db_xref="EnsemblGenomes-Tr:ABO10836"
FT                   /protein_id="ABO10836.1"
FT                   /translation="MSEQPISPTVQLNTRGLRCPEPVMMLHQAIRKAKSGDVVEVLATD
FT                   PSTSWDIPKFCMHLGHELLLKEEVLDEQNHKEYRYLVQKG"
     MSEQPISPTV QLNTRGLRCP EPVMMLHQAI RKAKSGDVVE VLATDPSTSW DIPKFCMHLG        60
     HELLLKEEVL DEQNHKEYRY LVQKG                                              85
//

If you have problems or comments...

PBIL Back to PBIL home page