(data stored in ACNUC29543 zone)

EMBL: CP000521.PE359

CP000521.PE359       Location/Qualifiers
FT   CDS             412356..412736
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_3496"
FT                   /old_locus_tag="AS1_3496"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_3496"
FT                   /db_xref="EnsemblGenomes-Tr:ABS89921"
FT                   /protein_id="ABS89921.2"
FT                   /translation="MNDYFVKQSLIICLWFFCIAGLLRIEVSWLSENITILILFILIIL
FT                   GSVILGYSNTHFAPVPKVKMSLILHTRFMGFLLILDLLFGKSVWYFDLARNFGFLGLFL
FT                   LGTFIFYKRNLNLNVAKIPPFE"
     MNDYFVKQSL IICLWFFCIA GLLRIEVSWL SENITILILF ILIILGSVIL GYSNTHFAPV        60
     PKVKMSLILH TRFMGFLLIL DLLFGKSVWY FDLARNFGFL GLFLLGTFIF YKRNLNLNVA       120
     KIPPFE                                                                  126
//

If you have problems or comments...

PBIL Back to PBIL home page