(data stored in ACNUC29543 zone)

EMBL: CP000521.PE361

CP000521.PE361       Location/Qualifiers
FT   CDS             414723..415334
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0379"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0379"
FT                   /db_xref="EnsemblGenomes-Tr:ABO10838"
FT                   /protein_id="ABO10838.2"
FT                   /translation="MVNQNNSPSDMGKIPLSDDKNLMNIAQYLKGVQQSHKRSILPLEQ
FT                   WHPKHCGKMDLTVKANGEWWHEGQLIKRQALLDLFTKVLWKEEGKFYLKTPVEQIEIEV
FT                   EDEPLLVNQVDQIEISGDEFLQLTTTNQDVILVDAEHPIFMREYAGELRPYVHVRFGIN
FT                   ALIQRQAFYHLVNYGTLVENDKGETILQLKSGNLHLQLGT"
     MVNQNNSPSD MGKIPLSDDK NLMNIAQYLK GVQQSHKRSI LPLEQWHPKH CGKMDLTVKA        60
     NGEWWHEGQL IKRQALLDLF TKVLWKEEGK FYLKTPVEQI EIEVEDEPLL VNQVDQIEIS       120
     GDEFLQLTTT NQDVILVDAE HPIFMREYAG ELRPYVHVRF GINALIQRQA FYHLVNYGTL       180
     VENDKGETIL QLKSGNLHLQ LGT                                               203
//

If you have problems or comments...

PBIL Back to PBIL home page