(data stored in ACNUC29543 zone)

EMBL: CP000521.PE366

CP000521.PE366       Location/Qualifiers
FT   CDS             complement(419129..419323)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0385"
FT                   /product="putative Zinc-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0385"
FT                   /db_xref="EnsemblGenomes-Tr:ABO10844"
FT                   /protein_id="ABO10844.1"
FT                   /translation="MPRTFPCPRCGEPSVWEGNEFRPFCSERCKLIDLGAWANDEYRLP
FT                   TQDAPQQDKGSQHEDDYED"
     MPRTFPCPRC GEPSVWEGNE FRPFCSERCK LIDLGAWAND EYRLPTQDAP QQDKGSQHED        60
     DYED                                                                     64
//

If you have problems or comments...

PBIL Back to PBIL home page