(data stored in ACNUC29543 zone)

EMBL: CP000521.PE370

CP000521.PE370       Location/Qualifiers
FT   CDS             421322..421732
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0388"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0388"
FT                   /db_xref="EnsemblGenomes-Tr:ABO10847"
FT                   /protein_id="ABO10847.1"
FT                   /translation="MSQASPVYQGSCLCQGIRYEIKGDIGDIIQCHCQRCRKSNGTAFA
FT                   TNAPINSADFKITQGEDLIKKFAVNGVYRWFCSECGSPLISSRDAQPELYRLRIGTLDT
FT                   PLDQKPTMHIFAASKAEWECIHDDLPQYDERP"
     MSQASPVYQG SCLCQGIRYE IKGDIGDIIQ CHCQRCRKSN GTAFATNAPI NSADFKITQG        60
     EDLIKKFAVN GVYRWFCSEC GSPLISSRDA QPELYRLRIG TLDTPLDQKP TMHIFAASKA       120
     EWECIHDDLP QYDERP                                                       136
//

If you have problems or comments...

PBIL Back to PBIL home page